GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005232-TA|BGIBMGA005232-PA|undefined
         (399 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    23   6.1  

>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 22.6 bits (46), Expect = 6.1
 Identities = 9/31 (29%), Positives = 16/31 (51%)

Query: 188 KPLQSNVLDMVDALCSNPCSLDTNIQQQGIL 218
           KP  S+      ++CS+P S D  ++   +L
Sbjct: 591 KPASSSASSAPTSVCSSPRSEDKEVEDMPVL 621


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.132    0.392 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 104,689
Number of Sequences: 429
Number of extensions: 4081
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 399
length of database: 140,377
effective HSP length: 59
effective length of query: 340
effective length of database: 115,066
effective search space: 39122440
effective search space used: 39122440
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 45 (22.2 bits)