GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005221-TA|BGIBMGA005221-PA|undefined
         (138 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK127934-1|BAC87197.1|  154|Homo sapiens protein ( Homo sapiens ...    29   7.1  

>AK127934-1|BAC87197.1|  154|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46043 fis, clone SPLEN2042051. ).
          Length = 154

 Score = 28.7 bits (61), Expect = 7.1
 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 3/48 (6%)

Query: 54  SKVTVDLRIGSLSHQAILHMFTIKC---SADAEPHVRHCRCTKPTTSW 98
           SK  +D R+G ++ Q +L +FT +C      + P   HC        W
Sbjct: 61  SKPALDTRLGGIACQEVLRLFTPRCFTIGLRSRPCCPHCTVEHEGGEW 108


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.316    0.127    0.380 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,415,735
Number of Sequences: 224733
Number of extensions: 541126
Number of successful extensions: 744
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 744
Number of HSP's gapped (non-prelim): 1
length of query: 138
length of database: 73,234,838
effective HSP length: 83
effective length of query: 55
effective length of database: 54,581,999
effective search space: 3002009945
effective search space used: 3002009945
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 60 (28.3 bits)