GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005161-TA|BGIBMGA005161-PA|IPR000182|GCN5-related
N-acetyltransferase
         (199 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY656663-1|AAT68000.1|  148|Apis mellifera pteropsin protein.          21   6.0  

>AY656663-1|AAT68000.1|  148|Apis mellifera pteropsin protein.
          Length = 148

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 12/42 (28%), Positives = 18/42 (42%)

Query: 35 FHPKISAVDPGEDWMIVRPLQRSDYDKGFLQLLSQLTSVGNI 76
          + P+   V     W +  P+  SD   GFL +L  +  V  I
Sbjct: 40 YGPEAGNVSCSVSWEVHDPVTNSDTYIGFLFVLGLIVPVFTI 81


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.137    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 57,309
Number of Sequences: 429
Number of extensions: 2109
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 199
length of database: 140,377
effective HSP length: 55
effective length of query: 144
effective length of database: 116,782
effective search space: 16816608
effective search space used: 16816608
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 42 (21.0 bits)