GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005075-TA|BGIBMGA005075-PA|IPR003960|AAA-protein
subdomain, IPR003593|AAA ATPase, IPR003959|AAA ATPase, central region
         (388 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phospha...    23   5.9  

>AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phosphate
           dehydrogenase protein.
          Length = 363

 Score = 22.6 bits (46), Expect = 5.9
 Identities = 13/53 (24%), Positives = 22/53 (41%)

Query: 140 GLRSPARGLLLFGPPGNGKTLLARCVAAECSATFFSISAASLTSKYVGEGEKM 192
           GL    + + +F P G   T    C  A+  AT +      +   +V  G+K+
Sbjct: 233 GLMEIIKFVNIFFPGGKKTTFFESCGVADLIATCYGGRNRKICEAFVKTGKKI 285


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.133    0.382 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,375
Number of Sequences: 429
Number of extensions: 4001
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 388
length of database: 140,377
effective HSP length: 59
effective length of query: 329
effective length of database: 115,066
effective search space: 37856714
effective search space used: 37856714
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 45 (22.2 bits)