GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005011-TA|BGIBMGA005011-PA|undefined
         (121 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic ac...    22   2.2  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   3.0  
DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride...    20   9.1  
DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride...    20   9.1  
DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    20   9.1  
DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride...    20   9.1  

>AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha-3 protein.
          Length = 537

 Score = 21.8 bits (44), Expect = 2.2
 Identities = 9/18 (50%), Positives = 11/18 (61%)

Query: 11  VDFCESKTESLSNWVRQV 28
           V F    T ++S WVRQV
Sbjct: 336 VHFRSPSTHNMSPWVRQV 353


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.4 bits (43), Expect = 3.0
 Identities = 13/50 (26%), Positives = 25/50 (50%)

Query: 52   SLVRAETELVMKQRERARKWAQMQVDLGLSNKEEEIARRHREKIDYLWKN 101
            +L+R+  E  + + +RA   A+ Q     S ++   + R +  ID L +N
Sbjct: 1286 NLIRSSLETGIPRDQRAMTEARNQQQQASSQQQIPESMRSKALIDQLCRN 1335


>DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride
           channel variant 4 protein.
          Length = 489

 Score = 19.8 bits (39), Expect = 9.1
 Identities = 6/8 (75%), Positives = 7/8 (87%)

Query: 95  IDYLWKND 102
           I Y+WKND
Sbjct: 214 ITYVWKND 221


>DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride
           channel variant 3 protein.
          Length = 475

 Score = 19.8 bits (39), Expect = 9.1
 Identities = 6/8 (75%), Positives = 7/8 (87%)

Query: 95  IDYLWKND 102
           I Y+WKND
Sbjct: 214 ITYVWKND 221


>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 19.8 bits (39), Expect = 9.1
 Identities = 6/8 (75%), Positives = 7/8 (87%)

Query: 95  IDYLWKND 102
           I Y+WKND
Sbjct: 265 ITYVWKND 272


>DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride
           channel protein.
          Length = 458

 Score = 19.8 bits (39), Expect = 9.1
 Identities = 6/8 (75%), Positives = 7/8 (87%)

Query: 95  IDYLWKND 102
           I Y+WKND
Sbjct: 214 ITYVWKND 221


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.315    0.128    0.358 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,659
Number of Sequences: 429
Number of extensions: 1503
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of query: 121
length of database: 140,377
effective HSP length: 51
effective length of query: 70
effective length of database: 118,498
effective search space:  8294860
effective search space used:  8294860
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.7 bits)
S2: 39 (19.8 bits)