GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA005002-TA|BGIBMGA005002-PA|IPR011046|WD40-like,
IPR001680|WD-40 repeat
         (473 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450 monoo...    23   7.3  

>DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 499

 Score = 22.6 bits (46), Expect = 7.3
 Identities = 9/35 (25%), Positives = 20/35 (57%), Gaps = 2/35 (5%)

Query: 261 GHGPQ--LFQTFTVHQSPITKVSLSENYLISVCSE 293
           G GP+  +   F V+Q+ +  +++  N+ + VC +
Sbjct: 438 GDGPRNCIGARFAVYQTKVGLITILRNHKVEVCEK 472


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.135    0.425 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 140,641
Number of Sequences: 429
Number of extensions: 5622
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 6
Number of HSP's gapped (non-prelim): 1
length of query: 473
length of database: 140,377
effective HSP length: 60
effective length of query: 413
effective length of database: 114,637
effective search space: 47345081
effective search space used: 47345081
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 45 (22.2 bits)