GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA004825-TA|BGIBMGA004825-PA|IPR006133|DNA polymerase B,
exonuclease, IPR006134|DNA polymerase B region, IPR013697|Domain of
unknown function DUF1744, IPR012337|Polynucleotidyl transferase,
Ribonuclease H fold, IPR006172|DNA-directed DNA polymerase B
         (2091 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.    26   3.7  

>DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.
          Length = 471

 Score = 25.8 bits (54), Expect = 3.7
 Identities = 13/60 (21%), Positives = 29/60 (48%)

Query: 1588 GLQAALGRGRTERAGPALLAVQAALSLPALTALMPGLVDYPIVPLHVRDVETLYNTLEWQ 1647
            G+ A L R   ++A   LLA+   L +  ++ L+ GL+   ++   + + +   +   W+
Sbjct: 385  GISAGLNRTAGQQAAYQLLALVITLGIAIVSGLITGLIMRVLICGSISEEQKFDDEAHWE 444


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.320    0.135    0.402 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 585,752
Number of Sequences: 429
Number of extensions: 26069
Number of successful extensions: 43
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 42
Number of HSP's gapped (non-prelim): 1
length of query: 2091
length of database: 140,377
effective HSP length: 69
effective length of query: 2022
effective length of database: 110,776
effective search space: 223989072
effective search space used: 223989072
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 51 (24.6 bits)