GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA004686-TA|BGIBMGA004686-PA|IPR006876|LMBR1-like
conserved region
         (693 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.               27   0.68 

>DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.
          Length = 152

 Score = 26.6 bits (56), Expect = 0.68
 Identities = 12/45 (26%), Positives = 26/45 (57%)

Query: 525 MLVVLLCLATYLSLGSRVLTLCGFQQFVGDDELTTDLVDEGREIV 569
           +L+  LC+ +Y+ +    +TLC  Q+ +  D++ + L DE   ++
Sbjct: 6   ILLFTLCIVSYMMVRCDDITLCLKQENLNLDDIDSLLEDESERML 50


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.324    0.137    0.422 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 184,692
Number of Sequences: 429
Number of extensions: 7462
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 1
length of query: 693
length of database: 140,377
effective HSP length: 62
effective length of query: 631
effective length of database: 113,779
effective search space: 71794549
effective search space used: 71794549
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 47 (23.0 bits)