GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA004645-TA|BGIBMGA004645-PA|IPR001680|WD-40 repeat,
IPR011046|WD40-like
         (374 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                26   0.60 

>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 25.8 bits (54), Expect = 0.60
 Identities = 13/41 (31%), Positives = 20/41 (48%)

Query: 81  VWTQGDDGKWATTLVLLRINRAATCVKWSPMENKFAVGSGA 121
           +W   +DGK       L+ +     V++SPME    VG+ A
Sbjct: 9   LWCPDNDGKMVDLTQCLQESSTGQSVEFSPMELNALVGTPA 49


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.133    0.424 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,938
Number of Sequences: 429
Number of extensions: 5647
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 374
length of database: 140,377
effective HSP length: 59
effective length of query: 315
effective length of database: 115,066
effective search space: 36245790
effective search space used: 36245790
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 44 (21.8 bits)