GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA004622-TA|BGIBMGA004622-PA|IPR000169|Peptidase, cysteine
peptidase active site, IPR000668|Peptidase C1A, papain C-terminal,
IPR013128|Peptidase C1A, papain, IPR013201|Proteinase inhibitor I29,
cathepsin propeptide
         (241 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.        24   1.4  

>L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.
          Length = 382

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 15/44 (34%), Positives = 22/44 (50%)

Query: 138 MGCDGGSLRGALRYAAREGLVMESHYPYVGKKGYCRYDSNLVRA 181
           +G  GG ++ ALR A +     +   PY   K   R D++L RA
Sbjct: 270 VGLVGGRVKEALRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRA 313


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.324    0.137    0.442 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 74,431
Number of Sequences: 429
Number of extensions: 3212
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 241
length of database: 140,377
effective HSP length: 56
effective length of query: 185
effective length of database: 116,353
effective search space: 21525305
effective search space used: 21525305
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 43 (21.4 bits)