GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA004572-TA|BGIBMGA004572-PA|undefined
         (91 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB028947-1|BAA82976.2|  917|Homo sapiens KIAA1024 protein protein.     27   6.9  

>AB028947-1|BAA82976.2|  917|Homo sapiens KIAA1024 protein protein.
          Length = 917

 Score = 27.5 bits (58), Expect = 6.9
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 3/49 (6%)

Query: 3   EIDQGSTGFLNPKYVWRKLNKGILSICDLIMIEASERNDKRNIFYWMED 51
           E+ +G   +   +Y     +KG L+  DL   +  E  +  N+ YWMED
Sbjct: 823 EVKRGQPSWTIEEYARNAGDKGKLTALDL---QTQESLNPNNLEYWMED 868


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.320    0.136    0.445 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,077,118
Number of Sequences: 224733
Number of extensions: 464056
Number of successful extensions: 827
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 827
Number of HSP's gapped (non-prelim): 1
length of query: 91
length of database: 73,234,838
effective HSP length: 69
effective length of query: 22
effective length of database: 57,728,261
effective search space: 1270021742
effective search space used: 1270021742
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 57 (27.1 bits)