GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA004558-TA|BGIBMGA004558-PA|IPR003349|Transcription
factor jumonji, JmjN, IPR003347|Transcription factor jumonji/aspartyl
beta-hydroxylase, IPR001965|Zinc finger, PHD-type, IPR001606|AT-rich
interaction region, IPR013129|Transcription factor jumonji,
IPR004198|Zinc finger, C5HC2-type, IPR013637|PLU-1-like,
IPR011011|Zinc finger, FYVE/PHD-type
         (1490 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    25   6.1  

>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 24.6 bits (51), Expect = 6.1
 Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 1/35 (2%)

Query: 318 PAPNTHPDDPLAKYMCHVCGRGDVEEQMLLCDGCD 352
           P PN HP  P+    C +     V+ Q  + DG D
Sbjct: 126 PTPNGHPSTPIVYASCKLQAAA-VDHQGSVLDGPD 159


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.133    0.409 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 414,116
Number of Sequences: 429
Number of extensions: 17130
Number of successful extensions: 23
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 23
Number of HSP's gapped (non-prelim): 1
length of query: 1490
length of database: 140,377
effective HSP length: 67
effective length of query: 1423
effective length of database: 111,634
effective search space: 158855182
effective search space used: 158855182
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 50 (24.2 bits)