GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA004535-TA|BGIBMGA004535-PA|undefined
         (61 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    19   3.5  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 19.4 bits (38), Expect = 3.5
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 7/49 (14%)

Query: 13   AALAEALRKQTALSKRYSQSSGAEAEHALAPHDLDVERLSSHSHTETAV 61
            AAL EALR +TA      Q    +AE+A    +LD E L  +  T  A+
Sbjct: 1147 AALHEALRGRTA------QLIIVQAENAYPEVELDRE-LRPYLRTAAAI 1188


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.306    0.117    0.301 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,320
Number of Sequences: 429
Number of extensions: 263
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 61
length of database: 140,377
effective HSP length: 41
effective length of query: 20
effective length of database: 122,788
effective search space:  2455760
effective search space used:  2455760
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 35 (18.5 bits)
S2: 35 (18.2 bits)