GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA004525-TA|BGIBMGA004525-PA|IPR005828|General substrate
transporter
         (338 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    23   5.0  

>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 10/31 (32%), Positives = 18/31 (58%)

Query: 257 FSSTFMFVNIKSAPYLFSLFGVDGTLCFYAL 287
           F++T +FV +K  P++  L    G + + AL
Sbjct: 223 FNTTTIFVPVKPCPWICELTNDAGYVVYSAL 253


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.328    0.140    0.414 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 87,298
Number of Sequences: 429
Number of extensions: 3534
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 338
length of database: 140,377
effective HSP length: 58
effective length of query: 280
effective length of database: 115,495
effective search space: 32338600
effective search space used: 32338600
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 44 (21.8 bits)