GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA004507-TA|BGIBMGA004507-PA|IPR007114|Major facilitator
superfamily, IPR005829|Sugar transporter superfamily,
IPR005828|General substrate transporter
         (490 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      23   7.6  

>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 22.6 bits (46), Expect = 7.6
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 423 LFFYVGVDGAFCLHAMILLYSMLVSYIMLPETK 455
           +F+   V   F ++  + LY++ V+ I  P+TK
Sbjct: 121 VFYNTAVWARFNVNEQMYLYALSVAVIHRPDTK 153


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.326    0.141    0.421 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,838
Number of Sequences: 429
Number of extensions: 4563
Number of successful extensions: 10
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 2
length of query: 490
length of database: 140,377
effective HSP length: 60
effective length of query: 430
effective length of database: 114,637
effective search space: 49293910
effective search space used: 49293910
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 46 (22.6 bits)