GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA004455-TA|BGIBMGA004455-PA|IPR004943|Lepidopteran low
molecular weight lipoprotein
         (254 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly pro...    23   3.6  

>AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 452

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 170 LGVN-TNGHGGHMAYGVNSVDSFRTQWYLQPAKYDNDVLFFIYNREYS 216
           + VN T G GG ++  V ++D   T  Y+  A +  D L    N + S
Sbjct: 175 IAVNATTGKGGLVSLAVQAIDLANTLVYM--ADHKGDALIVYQNADDS 220


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.322    0.138    0.429 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,976
Number of Sequences: 429
Number of extensions: 3583
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 254
length of database: 140,377
effective HSP length: 56
effective length of query: 198
effective length of database: 116,353
effective search space: 23037894
effective search space used: 23037894
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 43 (21.4 bits)