GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA004404-TA|BGIBMGA004404-PA|IPR004943|Lepidopteran low
molecular weight lipoprotein
         (251 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    21   8.1  

>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated
          chloride channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 14/48 (29%), Positives = 20/48 (41%)

Query: 34 DVIIADYDSAVERSKLIYTDNKGELITNVVNNLIRNNKMNCMEYAYQL 81
          D I+  YD+ +  S    TD    +  N+    I       MEY+ QL
Sbjct: 37 DNILGGYDARIRPSGENATDGPAVVRVNIFVRSISKIDDVTMEYSVQL 84


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.136    0.413 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,049
Number of Sequences: 429
Number of extensions: 3642
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 251
length of database: 140,377
effective HSP length: 56
effective length of query: 195
effective length of database: 116,353
effective search space: 22688835
effective search space used: 22688835
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 43 (21.4 bits)