GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA004251-TA|BGIBMGA004251-PA|IPR009006|Alanine
racemase/group IV decarboxylase, C-terminal, IPR002433|Ornithine
decarboxylase, IPR000183|Orn/DAP/Arg decarboxylase 2
         (444 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    24   3.0  

>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 23.8 bits (49), Expect = 3.0
 Identities = 14/40 (35%), Positives = 20/40 (50%)

Query: 349 ALDCVMESALLPPLDAGDWLVFRDMGAYTIPIASPFNGFP 388
           A + V  S L P LD+ D L  R++ A  +  A   +G P
Sbjct: 409 ASELVESSVLFPSLDSRDELHPRELEAVNLGSACRIHGSP 448


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.323    0.137    0.423 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,028
Number of Sequences: 429
Number of extensions: 3857
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 6
Number of HSP's gapped (non-prelim): 1
length of query: 444
length of database: 140,377
effective HSP length: 60
effective length of query: 384
effective length of database: 114,637
effective search space: 44020608
effective search space used: 44020608
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 45 (22.2 bits)