GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003977-TA|BGIBMGA003977-PA|IPR006195|Aminoacyl-transfer
RNA synthetase, class II, IPR002317|Seryl-tRNA synthetase, class IIa,
IPR002314|tRNA synthetase, class II (G, H, P and S),
IPR010978|tRNA-binding arm
         (494 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB194707-1|BAD69622.1|  247|Apis mellifera heme oxygenase protein.     24   2.5  

>AB194707-1|BAD69622.1|  247|Apis mellifera heme oxygenase protein.
          Length = 247

 Score = 24.2 bits (50), Expect = 2.5
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 347 NNAEEFCKALGLPYRVVNIVSGALNHA--ASKKLDLEAWFPGSGAFREL 393
           NN + FCK +    + ++ +S +L +A  A   LD   W  G   F E+
Sbjct: 4   NNQDTFCKKMRKATKEIHSISDSLVNAKLAFGFLDNSVWADGLLVFYEV 52


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.135    0.396 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 139,102
Number of Sequences: 429
Number of extensions: 6264
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 494
length of database: 140,377
effective HSP length: 60
effective length of query: 434
effective length of database: 114,637
effective search space: 49752458
effective search space used: 49752458
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 46 (22.6 bits)