GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003960-TA|BGIBMGA003960-PA|IPR002645|Sulfate
transporter/antisigma-factor antagonist STAS, IPR001902|Sulphate anion
transporter, IPR011547|Sulphate transporter
         (558 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ245824-1|CAB76374.1|  399|Apis mellifera G-protein coupled rec...    23   6.6  

>AJ245824-1|CAB76374.1|  399|Apis mellifera G-protein coupled
          receptor protein.
          Length = 399

 Score = 23.0 bits (47), Expect = 6.6
 Identities = 10/30 (33%), Positives = 18/30 (60%)

Query: 30 LVLVFNFFGINTSFPGITVGLTVIPQAIAY 59
          L +V NFF ++ +   + V + V+P  +AY
Sbjct: 67 LRIVQNFFIVSLAVADLAVAILVMPFNVAY 96


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.324    0.138    0.403 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 133,682
Number of Sequences: 429
Number of extensions: 5343
Number of successful extensions: 19
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 18
Number of HSP's gapped (non-prelim): 1
length of query: 558
length of database: 140,377
effective HSP length: 61
effective length of query: 497
effective length of database: 114,208
effective search space: 56761376
effective search space used: 56761376
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 46 (22.6 bits)