GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003648-TA|BGIBMGA003648-PA|IPR000569|HECT, IPR000048|IQ
calmodulin-binding region
         (1106 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             25   2.6  

>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 25.4 bits (53), Expect = 2.6
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 17  AGASAARKTDRDSLIQQTQLQRQKR-EEHRKRLNSVIKIQAYFRSYLTRKKCKQVERDQF 75
           A A+A   T    LI+Q  LQR    + H   L S   +Q + R Y  +++ +Q ++ + 
Sbjct: 119 ATAAATATTTATGLIKQETLQRHHHLQNHHHHLQST-AVQDHHRPYQQQQQQQQRQQQRQ 177

Query: 76  DD 77
           ++
Sbjct: 178 EE 179


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.322    0.137    0.412 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 307,680
Number of Sequences: 429
Number of extensions: 12877
Number of successful extensions: 40
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 35
Number of HSP's gapped (non-prelim): 6
length of query: 1106
length of database: 140,377
effective HSP length: 65
effective length of query: 1041
effective length of database: 112,492
effective search space: 117104172
effective search space used: 117104172
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 49 (23.8 bits)