GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003556-TA|BGIBMGA003556-PA|IPR013026|Tetratricopeptide
region, IPR001440|Tetratricopeptide TPR_1, IPR012308|DNA ligase,
N-terminal, IPR012310|ATP dependent DNA ligase, central,
IPR008940|Protein prenyltransferase
         (800 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB194707-1|BAD69622.1|  247|Apis mellifera heme oxygenase protein.     27   0.79 

>AB194707-1|BAD69622.1|  247|Apis mellifera heme oxygenase protein.
          Length = 247

 Score = 26.6 bits (56), Expect = 0.79
 Identities = 16/57 (28%), Positives = 27/57 (47%)

Query: 239 DGDTIMKYARLAAKIYHSNNEIERMLQVFGIAYKKCSSLFTLEDVNIFLEALISLKQ 295
           D DT  K    +  ++  NNEI R +Q  G    K +  F +  + +FL   +S ++
Sbjct: 190 DEDTKNKLIEESKTVFILNNEIIRSIQGTGTIILKKTVCFVIPIMLLFLAFFVSFRK 246


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.134    0.387 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 217,646
Number of Sequences: 429
Number of extensions: 8689
Number of successful extensions: 22
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 20
Number of HSP's gapped (non-prelim): 2
length of query: 800
length of database: 140,377
effective HSP length: 63
effective length of query: 737
effective length of database: 113,350
effective search space: 83538950
effective search space used: 83538950
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 47 (23.0 bits)