GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003512-TA|BGIBMGA003512-PA|IPR001360|Glycoside
hydrolase, family 1
         (502 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    26   0.84 
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          23   7.8  

>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 25.8 bits (54), Expect = 0.84
 Identities = 11/34 (32%), Positives = 19/34 (55%)

Query: 212 LCSDNLLKAHAESYHLYNEKYRPTQNGTVMISIN 245
           LCS++  +   + +  YN+  RP QN T  + +N
Sbjct: 22  LCSEDEERLVRDLFRGYNKLIRPVQNMTEKVHVN 55


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 22.6 bits (46), Expect = 7.8
 Identities = 8/13 (61%), Positives = 8/13 (61%)

Query: 13  CHTGLAAYTKFPD 25
           CHTGL  Y   PD
Sbjct: 274 CHTGLGHYGHHPD 286


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.137    0.438 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 167,593
Number of Sequences: 429
Number of extensions: 7691
Number of successful extensions: 14
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 12
Number of HSP's gapped (non-prelim): 2
length of query: 502
length of database: 140,377
effective HSP length: 61
effective length of query: 441
effective length of database: 114,208
effective search space: 50365728
effective search space used: 50365728
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 46 (22.6 bits)