GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003496-TA|BGIBMGA003496-
PA|IPR007070|Phosphatidylinositolglycan class N (PIG-N)
         (345 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              23   2.9  

>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 14/59 (23%), Positives = 26/59 (44%), Gaps = 1/59 (1%)

Query: 72  IINIFTKDHVGDHIYTNDFNPYSQSFSTYKNTTLLDDWVFRNV-KEFFQNAEEDVNLLA 129
           +I++ T  H G+++ T +    + S ST     +   W+     K F Q ++  V   A
Sbjct: 644 MISVITARHAGEYVCTAENAAGTASHSTTLTVNVPPRWILEPTDKAFAQGSDARVECKA 702


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.317    0.134    0.403 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 101,129
Number of Sequences: 429
Number of extensions: 4325
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 345
length of database: 140,377
effective HSP length: 58
effective length of query: 287
effective length of database: 115,495
effective search space: 33147065
effective search space used: 33147065
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 44 (21.8 bits)