GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003433-TA|BGIBMGA003433-PA|IPR000408|Regulator of
chromosome condensation, RCC1, IPR009091|Regulator of chromosome
condensation/beta-lactamase-inhibitor protein II
         (325 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    24   2.1  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 23.8 bits (49), Expect = 2.1
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 76  LWILNLEDNSIKNVYLDRELPLELSPKRNKTDNEIQKLVVNNFSCLYL 123
           L IL+L +NSI  +  +  LPL        +DN+++ +    F+ L++
Sbjct: 361 LQILDLRNNSIDRIESNAFLPLYNLHTLELSDNKLRTVGAQLFNGLFV 408


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.317    0.136    0.423 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,275
Number of Sequences: 429
Number of extensions: 4671
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 6
Number of HSP's gapped (non-prelim): 1
length of query: 325
length of database: 140,377
effective HSP length: 58
effective length of query: 267
effective length of database: 115,495
effective search space: 30837165
effective search space used: 30837165
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 44 (21.8 bits)