GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003373-TA|BGIBMGA003373-PA|undefined
         (287 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    22   7.2  

>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 9/38 (23%), Positives = 19/38 (50%)

Query: 233 KRKSPAATTWRGPHDVINRAQVACARVTEDAHKDECLS 270
           K K P AT +    ++IN +     + + ++   +C+S
Sbjct: 556 KSKPPVATMYGSDEEIINSSNDEGGKTSPNSAVRKCMS 593


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.315    0.131    0.384 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 65,829
Number of Sequences: 429
Number of extensions: 2162
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 287
length of database: 140,377
effective HSP length: 57
effective length of query: 230
effective length of database: 115,924
effective search space: 26662520
effective search space used: 26662520
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 43 (21.4 bits)