GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003368-TA|BGIBMGA003368-PA|IPR013818|Lipase, N-terminal,
IPR000734|Lipase
         (309 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    23   2.6  

>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 23.4 bits (48), Expect = 2.6
 Identities = 14/59 (23%), Positives = 26/59 (44%), Gaps = 6/59 (10%)

Query: 161 PSLQQAICSHGRAYLLFTESLINNNCSFRAYKWNLTYEGVNASIRATCDNIGSCSEMGI 219
           P++ ++ C     Y  F +      C  +   W  TY+G+   ++    N+G   E+GI
Sbjct: 138 PAIFKSSCEIDVRYFPFDQQ----TCFMKFGSW--TYDGIQIDLKHINQNMGDKVEIGI 190


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.135    0.431 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,651
Number of Sequences: 429
Number of extensions: 3515
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 309
length of database: 140,377
effective HSP length: 58
effective length of query: 251
effective length of database: 115,495
effective search space: 28989245
effective search space used: 28989245
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 44 (21.8 bits)