GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003295-TA|BGIBMGA003295-PA|IPR005599|Alg9-like
mannosyltransferase
         (599 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor pro...    25   1.3  

>DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor
           protein.
          Length = 405

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 323 TVLSSKSTSRASFCTPYWLDLMPLGLWLVIFML 355
           TV S +  +R  +  P W DL+  GL+ ++ ++
Sbjct: 18  TVSSGERDTRTEYYLPNWTDLVLAGLFTMLIIV 50


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.324    0.138    0.451 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 180,650
Number of Sequences: 429
Number of extensions: 8005
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 12
Number of HSP's gapped (non-prelim): 1
length of query: 599
length of database: 140,377
effective HSP length: 62
effective length of query: 537
effective length of database: 113,779
effective search space: 61099323
effective search space used: 61099323
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 46 (22.6 bits)