GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003276-TA|BGIBMGA003276-PA|undefined
         (114 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK126016-1|BAC86394.1|  172|Homo sapiens protein ( Homo sapiens ...    29   4.4  

>AK126016-1|BAC86394.1|  172|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44028 fis, clone TESTI4027516. ).
          Length = 172

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 61  GIQALDSLNSKATVNITAGGVGYPYVNMRMKSERGSGLSY 100
           G++ L S  + +  N +AGG  YP +N R  S  G G SY
Sbjct: 7   GLRHLFSAPAGSRCNSSAGGRSYPQINGRCNSSAG-GRSY 45


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.320    0.136    0.388 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,637,602
Number of Sequences: 224733
Number of extensions: 381132
Number of successful extensions: 460
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 455
Number of HSP's gapped (non-prelim): 6
length of query: 114
length of database: 73,234,838
effective HSP length: 80
effective length of query: 34
effective length of database: 55,256,198
effective search space: 1878710732
effective search space used: 1878710732
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 59 (27.9 bits)