GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003229-TA|BGIBMGA003229-PA|IPR000437|Prokaryotic
membrane lipoprotein lipid attachment site, IPR000731|Sterol-sensing
5TM box, IPR002202|Hydroxymethylglutaryl-coenzyme A reductase,
IPR004816|Hydroxymethylglutaryl-CoA reductase (NADPH),
IPR009029|Hydroxymethylglutaryl-CoA reductase, substrate-binding,
IPR003392|Patched
         (785 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450 monoo...    23   7.2  

>DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 548

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 10/31 (32%), Positives = 19/31 (61%)

Query: 301 SADYIVIATLLCALIIKFIFFEEQRNWVYDM 331
           SA  + ++ L+ ALI+ FI+F   R  + ++
Sbjct: 10  SASSVFLSLLIPALILYFIYFRISRRHLLEL 40


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.320    0.133    0.400 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 186,055
Number of Sequences: 429
Number of extensions: 6691
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 12
Number of HSP's gapped (non-prelim): 1
length of query: 785
length of database: 140,377
effective HSP length: 63
effective length of query: 722
effective length of database: 113,350
effective search space: 81838700
effective search space used: 81838700
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 47 (23.0 bits)