GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA003085-TA|BGIBMGA003085-PA|undefined
         (55 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB011089-1|BAA25443.1|  792|Homo sapiens KIAA0517 protein protein.     27   7.1  

>AB011089-1|BAA25443.1|  792|Homo sapiens KIAA0517 protein
          protein.
          Length = 792

 Score = 27.5 bits (58), Expect = 7.1
 Identities = 15/40 (37%), Positives = 20/40 (50%)

Query: 15 PVCKWSRLAGIEQLQLGERVGQIDDQALVYERYLKKKKKP 54
          P C+WSR+A          V QID Q L+    L++ K P
Sbjct: 42 PPCQWSRMASEGTNIPSPVVRQIDKQFLICSICLERYKNP 81


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.326    0.143    0.442 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,986,059
Number of Sequences: 224733
Number of extensions: 217952
Number of successful extensions: 382
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 382
Number of HSP's gapped (non-prelim): 1
length of query: 55
length of database: 73,234,838
effective HSP length: 35
effective length of query: 20
effective length of database: 65,369,183
effective search space: 1307383660
effective search space used: 1307383660
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 57 (27.1 bits)