GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002986-TA|BGIBMGA002986-PA|IPR000408|Regulator of
chromosome condensation, RCC1, IPR004838|Aminotransferases class-I
pyridoxal-phosphate-binding site, IPR004839|Aminotransferase, class I
and II, IPR005957|Animal tyrosine aminotransferase,
IPR005958|Tyrosine/nicotianamine aminotransferase,
IPR001176|1-aminocyclopropane-1-carboxylate synthase
         (442 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    23   6.8  

>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 22.6 bits (46), Expect = 6.8
 Identities = 11/34 (32%), Positives = 17/34 (50%)

Query: 342 YMMIEIKTNKFPEFKNELQFVERLMSEQSVFCLP 375
           Y M +I  +     KNE+  VE +   +S+ C P
Sbjct: 5   YQMKQITNSTTMSVKNEISTVEPVDPVKSLVCSP 38


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.137    0.405 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 126,568
Number of Sequences: 429
Number of extensions: 5467
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 10
Number of HSP's gapped (non-prelim): 1
length of query: 442
length of database: 140,377
effective HSP length: 60
effective length of query: 382
effective length of database: 114,637
effective search space: 43791334
effective search space used: 43791334
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 45 (22.2 bits)