GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002885-TA|BGIBMGA002885-PA|IPR000585|Hemopexin,
IPR001818|Peptidase M10A and M12B, matrixin and adamalysin,
IPR006025|Peptidase M, neutral zinc metallopeptidases, zinc-binding
site, IPR006026|Peptidase, metallopeptidases
         (436 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667183-1|ABG75735.1|  463|Apis mellifera GABA-gated ion channe...    23   3.8  
AF134820-1|AAD40235.1|  166|Apis mellifera putative Ets-family p...    23   5.0  

>DQ667183-1|ABG75735.1|  463|Apis mellifera GABA-gated ion channel
           protein.
          Length = 463

 Score = 23.4 bits (48), Expect = 3.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)

Query: 381 AIVWKEDTFFFQG 393
           A +WK DT+F+ G
Sbjct: 83  ARIWKPDTYFYNG 95


>AF134820-1|AAD40235.1|  166|Apis mellifera putative Ets-family
           protein protein.
          Length = 166

 Score = 23.0 bits (47), Expect = 5.0
 Identities = 10/40 (25%), Positives = 18/40 (45%)

Query: 193 LNVKGSEESEGTERTVGSSQAPRFTKTDSEEFDDAPDLCM 232
           LN+  S+  +  E    +SQ PR T   +    D  ++ +
Sbjct: 71  LNIISSDHDDSDEEYAANSQPPRITSVPNTSRLDKSEISL 110


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.320    0.138    0.439 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 147,598
Number of Sequences: 429
Number of extensions: 7580
Number of successful extensions: 12
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 10
Number of HSP's gapped (non-prelim): 2
length of query: 436
length of database: 140,377
effective HSP length: 60
effective length of query: 376
effective length of database: 114,637
effective search space: 43103512
effective search space used: 43103512
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 45 (22.2 bits)