GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002856-TA|BGIBMGA002856-PA|IPR011011|Zinc finger,
FYVE/PHD-type, IPR001841|Zinc finger, RING-type
         (424 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB208107-1|BAE72139.1|   71|Apis mellifera Broad complex zinc fi...    23   6.5  
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    22   8.5  

>AB208107-1|BAE72139.1|   71|Apis mellifera Broad complex zinc
          finger domain-Z2 isoform protein.
          Length = 71

 Score = 22.6 bits (46), Expect = 6.5
 Identities = 8/11 (72%), Positives = 8/11 (72%)

Query: 19 CGECERYYCSR 29
          C  CER YCSR
Sbjct: 38 CVICERVYCSR 48


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 22.2 bits (45), Expect = 8.5
 Identities = 17/54 (31%), Positives = 25/54 (46%)

Query: 175 IPQVTPEGERTPSRSPSVPLDTADCFEIEDLDDQGWELITRPADPLPNDSEILL 228
           +PQ    G    +++ SV LDTA C     L +  +E+ T     LP    I+L
Sbjct: 187 VPQAIQFGVVYENKNGSVILDTARCSMKWTLIEHAFEISTMLFFVLPMTIIIVL 240


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.133    0.414 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,553
Number of Sequences: 429
Number of extensions: 4437
Number of successful extensions: 15
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 13
Number of HSP's gapped (non-prelim): 2
length of query: 424
length of database: 140,377
effective HSP length: 60
effective length of query: 364
effective length of database: 114,637
effective search space: 41727868
effective search space used: 41727868
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 45 (22.2 bits)