BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002845-TA|BGIBMGA002845-PA|IPR009543|Vacuolar protein
sorting-associated protein
(1354 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 26 5.9
>AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase
protein.
Length = 1173
Score = 26.2 bits (55), Expect = 5.9
Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 4/71 (5%)
Query: 930 ALKPLAVRLEERLILVLWSWWREEDEDSAQEQVDEADYETRRMLHSLTALSATRY---YF 986
AL +R EER I + SW E D D++Q T R++ + A R+ F
Sbjct: 880 ALSAGILRAEER-INTMQSWQEEWDADASQADASRFVRWTHRVIPDIAAWHFRRHGEVNF 938
Query: 987 GLLKIIPSQGY 997
L +++ G+
Sbjct: 939 HLSQVLSGHGF 949
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.320 0.134 0.413
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,119,267
Number of Sequences: 2123
Number of extensions: 40077
Number of successful extensions: 67
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 67
Number of HSP's gapped (non-prelim): 1
length of query: 1354
length of database: 516,269
effective HSP length: 72
effective length of query: 1282
effective length of database: 363,413
effective search space: 465895466
effective search space used: 465895466
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 54 (25.8 bits)
- SilkBase 1999-2023 -