SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002845-TA|BGIBMGA002845-PA|IPR009543|Vacuolar protein
sorting-associated protein
         (1354 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript...    26   5.9  

>AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1173

 Score = 26.2 bits (55), Expect = 5.9
 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 4/71 (5%)

Query: 930 ALKPLAVRLEERLILVLWSWWREEDEDSAQEQVDEADYETRRMLHSLTALSATRY---YF 986
           AL    +R EER I  + SW  E D D++Q         T R++  + A    R+    F
Sbjct: 880 ALSAGILRAEER-INTMQSWQEEWDADASQADASRFVRWTHRVIPDIAAWHFRRHGEVNF 938

Query: 987 GLLKIIPSQGY 997
            L +++   G+
Sbjct: 939 HLSQVLSGHGF 949


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.134    0.413 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,119,267
Number of Sequences: 2123
Number of extensions: 40077
Number of successful extensions: 67
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 67
Number of HSP's gapped (non-prelim): 1
length of query: 1354
length of database: 516,269
effective HSP length: 72
effective length of query: 1282
effective length of database: 363,413
effective search space: 465895466
effective search space used: 465895466
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 54 (25.8 bits)

- SilkBase 1999-2023 -