GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002843-TA|BGIBMGA002843-PA|undefined
         (1415 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D pro...    29   0.30 

>EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D
           protein.
          Length = 255

 Score = 28.7 bits (61), Expect = 0.30
 Identities = 11/44 (25%), Positives = 23/44 (52%)

Query: 883 ALRAVLAPLRSEDAPAPQASPATEDDDEASVRSETDRSESSSHN 926
           +LR V+ P    D P+    P  E+DD++++     +++  + N
Sbjct: 196 SLRCVVPPTEDCDVPSTIPPPPPEEDDDSNIPQNNPKNKQHNFN 239


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.319    0.133    0.410 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 261,524
Number of Sequences: 317
Number of extensions: 9489
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 12
Number of HSP's gapped (non-prelim): 1
length of query: 1415
length of database: 114,650
effective HSP length: 65
effective length of query: 1350
effective length of database: 94,045
effective search space: 126960750
effective search space used: 126960750
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 49 (23.8 bits)