GeneModel BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002829-TA|BGIBMGA002829-PA|IPR001787|Ribosomal protein
L21
         (176 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018)               28   4.9  

>SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018)
          Length = 3561

 Score = 27.9 bits (59), Expect = 4.9
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 92   QITLDKVLVAATKDFSLIGRPLVQPGLVTVTATIISKG 129
            Q++LD V V  T     +  PL+ PG+   T  ++ +G
Sbjct: 1999 QLSLDTVRVQDTAVIHCVTSPLIDPGIFFYTRAVVIEG 2036


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.320    0.136    0.387 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,940,936
Number of Sequences: 59808
Number of extensions: 171403
Number of successful extensions: 391
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 390
Number of HSP's gapped (non-prelim): 1
length of query: 176
length of database: 16,821,457
effective HSP length: 78
effective length of query: 98
effective length of database: 12,156,433
effective search space: 1191330434
effective search space used: 1191330434
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 57 (27.1 bits)