SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002822-TA|BGIBMGA002822-PA|undefined
         (175 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          24   0.72 
AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    21   6.7  

>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 24.2 bits (50), Expect = 0.72
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 88  HHGSKTSEGKDLAAFMEDI--HSNSIVRAGSSQYSISS 123
           HHGSK+   +D+ A +E +  H  S+ +A S+ + I S
Sbjct: 405 HHGSKSWTQEDMDAALEALRNHDMSLTKA-SATFGIPS 441


>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
           protein.
          Length = 1308

 Score = 21.0 bits (42), Expect = 6.7
 Identities = 8/10 (80%), Positives = 9/10 (90%)

Query: 141 KWLAHKDSLG 150
           K+L HKDSLG
Sbjct: 502 KFLMHKDSLG 511


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.130    0.400 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 55,351
Number of Sequences: 429
Number of extensions: 2344
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of query: 175
length of database: 140,377
effective HSP length: 54
effective length of query: 121
effective length of database: 117,211
effective search space: 14182531
effective search space used: 14182531
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 41 (20.6 bits)

- SilkBase 1999-2023 -