SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002821-TA|BGIBMGA002821-PA|IPR001623|Heat shock protein
DnaJ, N-terminal, IPR012336|Thioredoxin-like fold, IPR003095|Heat
shock protein DnaJ
         (711 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M29494-1|AAA27729.1|   74|Apis mellifera protein ( Bee homeobox-...    25   2.8  

>M29494-1|AAA27729.1|   74|Apis mellifera protein ( Bee
           homeobox-containing gene,partial cds, clone H15. ).
          Length = 74

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 108 RHDYSQYARFSNDPFE-EFFGTHFRTQDQDITLFHKLSVTARHFE 151
           R     Y RF     E EF   H+ T+ + I + H L +T R  +
Sbjct: 9   RRGRQTYTRFQTLELEKEFHYNHYLTRRRRIEIAHALCLTERQIK 53


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.324    0.136    0.433 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 165,543
Number of Sequences: 429
Number of extensions: 5911
Number of successful extensions: 12
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 12
Number of HSP's gapped (non-prelim): 1
length of query: 711
length of database: 140,377
effective HSP length: 63
effective length of query: 648
effective length of database: 113,350
effective search space: 73450800
effective search space used: 73450800
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 47 (23.0 bits)

- SilkBase 1999-2023 -