SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002816-TA|BGIBMGA002816-PA|IPR013838|Beta tubulin,
autoregulation binding site, IPR008954|Moesin
         (296 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface pro...    21   8.3  

>AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface
           protein chaoptin protein.
          Length = 782

 Score = 21.4 bits (43), Expect = 8.3
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 4/35 (11%)

Query: 265 LNRVEELETENSHLTKRLDK----LKNAKSALLKD 295
           LNR+EEL+  N+ L    D     L++ K   L+D
Sbjct: 41  LNRLEELDLSNNRLRNVPDNSFHFLRSLKKVHLQD 75


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.312    0.128    0.340 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 45,084
Number of Sequences: 317
Number of extensions: 1450
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 296
length of database: 114,650
effective HSP length: 56
effective length of query: 240
effective length of database: 96,898
effective search space: 23255520
effective search space used: 23255520
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 43 (21.4 bits)

- SilkBase 1999-2023 -