GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002812-TA|BGIBMGA002812-PA|IPR006155|Machado-Joseph
disease protein MJD
         (241 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY321476-1|AAQ23386.1|  253|Tribolium castaneum Ash protein.           22   4.9  

>AY321476-1|AAQ23386.1|  253|Tribolium castaneum Ash protein.
          Length = 253

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 11/37 (29%), Positives = 15/37 (40%)

Query: 179 QLWMHQYVLPTPEPNYCPKLPLNGESPSESISSNGQY 215
           Q   +Q +LPTP  +     P    S   S S+   Y
Sbjct: 183 QYQSYQILLPTPTCSEASSSPTPSHSSESSFSAASSY 219


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.319    0.136    0.420 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 65,766
Number of Sequences: 317
Number of extensions: 3033
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 241
length of database: 114,650
effective HSP length: 55
effective length of query: 186
effective length of database: 97,215
effective search space: 18081990
effective search space used: 18081990
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 42 (21.0 bits)