SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002804-TA|BGIBMGA002804-PA|IPR001452|Src homology-3,
IPR000219|DH, IPR000108|Neutrophil cytosol factor 2
         (351 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              25   1.3  

>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 275 AQPDELSLAEGDV-VNVTRKTAEGWYYGERTRDGEAGWFPGAYSAEIASPHVRARNLRQR 333
           + PD +S+ +G + +N  +KT EG+Y  E      AG     + +  A PH   +   Q 
Sbjct: 729 SNPD-ISVEDGTLSINNIQKTNEGYYLCEAVNGIGAGLSAVIFISVQAPPHFEIKLKNQT 787

Query: 334 YR 335
            R
Sbjct: 788 AR 789


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.133    0.411 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,289
Number of Sequences: 429
Number of extensions: 3140
Number of successful extensions: 16
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 15
Number of HSP's gapped (non-prelim): 1
length of query: 351
length of database: 140,377
effective HSP length: 58
effective length of query: 293
effective length of database: 115,495
effective search space: 33840035
effective search space used: 33840035
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 44 (21.8 bits)

- SilkBase 1999-2023 -