BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002804-TA|BGIBMGA002804-PA|IPR001452|Src homology-3,
IPR000219|DH, IPR000108|Neutrophil cytosol factor 2
(351 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 25 1.3
>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
Length = 1946
Score = 24.6 bits (51), Expect = 1.3
Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 2/62 (3%)
Query: 275 AQPDELSLAEGDV-VNVTRKTAEGWYYGERTRDGEAGWFPGAYSAEIASPHVRARNLRQR 333
+ PD +S+ +G + +N +KT EG+Y E AG + + A PH + Q
Sbjct: 729 SNPD-ISVEDGTLSINNIQKTNEGYYLCEAVNGIGAGLSAVIFISVQAPPHFEIKLKNQT 787
Query: 334 YR 335
R
Sbjct: 788 AR 789
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.319 0.133 0.411
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,289
Number of Sequences: 429
Number of extensions: 3140
Number of successful extensions: 16
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 15
Number of HSP's gapped (non-prelim): 1
length of query: 351
length of database: 140,377
effective HSP length: 58
effective length of query: 293
effective length of database: 115,495
effective search space: 33840035
effective search space used: 33840035
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 44 (21.8 bits)
- SilkBase 1999-2023 -