SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002790-TA|BGIBMGA002790-PA|IPR000555|Mov34/MPN/PAD-1,
IPR003639|Mov34-1
         (348 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ010299-1|CAA09070.1|  722|Anopheles gambiae stat protein.            23   9.5  

>AJ010299-1|CAA09070.1|  722|Anopheles gambiae stat protein.
          Length = 722

 Score = 23.4 bits (48), Expect = 9.5
 Identities = 10/50 (20%), Positives = 28/50 (56%)

Query: 2   ASTSADAQASIAQKTWVMANNIETVSNVDDIYRYDKKQQQDILAAKPWEK 51
           +S++ +A+ S +  +    +N   ++N+D+IY+++ +    +     WE+
Sbjct: 672 SSSTPNAEQSPSASSKDTFSNEYVLTNLDEIYKFEIENDDMLSIQDYWEQ 721


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.317    0.131    0.393 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 335,265
Number of Sequences: 2123
Number of extensions: 12422
Number of successful extensions: 23
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 22
Number of HSP's gapped (non-prelim): 1
length of query: 348
length of database: 516,269
effective HSP length: 65
effective length of query: 283
effective length of database: 378,274
effective search space: 107051542
effective search space used: 107051542
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 48 (23.4 bits)

- SilkBase 1999-2023 -