BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002790-TA|BGIBMGA002790-PA|IPR000555|Mov34/MPN/PAD-1,
IPR003639|Mov34-1
(348 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 9.5
>AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein.
Length = 722
Score = 23.4 bits (48), Expect = 9.5
Identities = 10/50 (20%), Positives = 28/50 (56%)
Query: 2 ASTSADAQASIAQKTWVMANNIETVSNVDDIYRYDKKQQQDILAAKPWEK 51
+S++ +A+ S + + +N ++N+D+IY+++ + + WE+
Sbjct: 672 SSSTPNAEQSPSASSKDTFSNEYVLTNLDEIYKFEIENDDMLSIQDYWEQ 721
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.317 0.131 0.393
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 335,265
Number of Sequences: 2123
Number of extensions: 12422
Number of successful extensions: 23
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 22
Number of HSP's gapped (non-prelim): 1
length of query: 348
length of database: 516,269
effective HSP length: 65
effective length of query: 283
effective length of database: 378,274
effective search space: 107051542
effective search space used: 107051542
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 48 (23.4 bits)
- SilkBase 1999-2023 -