GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002788-TA|BGIBMGA002788-PA|IPR001781|LIM, zinc-binding
         (324 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ067178-1|AAZ20250.1|  448|Apis mellifera conserved ATPase doma...    29   0.072

>DQ067178-1|AAZ20250.1|  448|Apis mellifera conserved ATPase domain
           protein protein.
          Length = 448

 Score = 28.7 bits (61), Expect = 0.072
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 3/50 (6%)

Query: 198 PDYHNLFSPRCAYCNGPILDKCVTALEKTWHTE--HFFCAQCGQQFGEEG 245
           PD HN  + +   C  P LD CV  + + W     H  C Q G      G
Sbjct: 159 PDIHNSVTGKTTACFEPSLDYCVVKIPR-WDLGKFHRVCTQIGSSMKSVG 207


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.136    0.457 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 92,313
Number of Sequences: 429
Number of extensions: 3827
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 324
length of database: 140,377
effective HSP length: 58
effective length of query: 266
effective length of database: 115,495
effective search space: 30721670
effective search space used: 30721670
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 44 (21.8 bits)