SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002784-TA|BGIBMGA002784-PA|IPR003533|Doublecortin
         (196 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC25B8.14 |mal2||kinetochore protein Mal2 |Schizosaccharomyces...    27   1.8  

>SPAC25B8.14 |mal2||kinetochore protein Mal2 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 303

 Score = 27.1 bits (57), Expect = 1.8
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 149 EELEDGASYVVSSYKTFKYSYRSVVLRRYAIATFVARLHYMDQ 191
           EELE G  + V  Y  F+  + S  L +Y I +F+    + D+
Sbjct: 140 EELEGGNRFDVPYYIIFRVFHDSFALYKYTIPSFLNIQEWADE 182


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.324    0.141    0.433 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 719,647
Number of Sequences: 5004
Number of extensions: 27696
Number of successful extensions: 40
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 39
Number of HSP's gapped (non-prelim): 1
length of query: 196
length of database: 2,362,478
effective HSP length: 69
effective length of query: 127
effective length of database: 2,017,202
effective search space: 256184654
effective search space used: 256184654
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -