SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002770-TA|BGIBMGA002770-PA|IPR000618|Insect cuticle
protein
         (125 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ288083-1|CAB93851.1|  355|Homo sapiens galectin-9 protein.           29   5.7  

>AJ288083-1|CAB93851.1|  355|Homo sapiens galectin-9 protein.
          Length = 355

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 26 SVADPYTGDFKNQVESRLGNNVKGQYSLLESDGTRRTVDYAAGAEGFNAVVRKDP 80
          S A P++G  +  ++  L   V G  ++L S GTR  VD+  G  G +     +P
Sbjct: 12 SPAVPFSGTIQGGLQDGLQITVNG--TVLSSSGTRFAVDFQTGFSGNDIAFHFNP 64


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.319    0.139    0.414 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,241,252
Number of Sequences: 224733
Number of extensions: 357326
Number of successful extensions: 492
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 492
Number of HSP's gapped (non-prelim): 1
length of query: 125
length of database: 73,234,838
effective HSP length: 81
effective length of query: 44
effective length of database: 55,031,465
effective search space: 2421384460
effective search space used: 2421384460
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 59 (27.9 bits)

- SilkBase 1999-2023 -