SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002768-TA|BGIBMGA002768-PA|undefined
         (325 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex det...    26   0.51 

>AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex
           determiner protein.
          Length = 385

 Score = 25.8 bits (54), Expect = 0.51
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 215 ENRVVRYHARLKKRSQDLREQCEAMSVRDITPQLKLEEVP 254
           EN   +Y    K+RS+D RE+  +   R I P   +E++P
Sbjct: 286 ENSYRKYRETSKERSRDRRERGRSREHR-IIPSHYIEQIP 324


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.133    0.386 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,159
Number of Sequences: 429
Number of extensions: 3608
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 325
length of database: 140,377
effective HSP length: 58
effective length of query: 267
effective length of database: 115,495
effective search space: 30837165
effective search space used: 30837165
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 44 (21.8 bits)

- SilkBase 1999-2023 -