BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002760-TA|BGIBMGA002760-PA|IPR001394|Peptidase C19,
ubiquitin carboxyl-terminal hydrolase 2
(125 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 26 0.45
>DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin
reductase protein.
Length = 487
Score = 25.8 bits (54), Expect = 0.45
Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 2/41 (4%)
Query: 3 CVMGSKDPATPAEGRCVCADVGSNNSGYYRLQAVLTHRGRS 43
CV + A P R +C VG+ +G+Y Q +L H S
Sbjct: 18 CVFRNASTAAPIRPR-ICI-VGAGPAGFYTAQYILKHLDNS 56
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.317 0.136 0.446
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 146,628
Number of Sequences: 2123
Number of extensions: 5398
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 125
length of database: 516,269
effective HSP length: 57
effective length of query: 68
effective length of database: 395,258
effective search space: 26877544
effective search space used: 26877544
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 43 (21.4 bits)
- SilkBase 1999-2023 -