SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002760-TA|BGIBMGA002760-PA|IPR001394|Peptidase C19,
ubiquitin carboxyl-terminal hydrolase 2
         (125 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ013245-1|AAY34441.1|  487|Anopheles gambiae adrenodoxin reduct...    26   0.45 

>DQ013245-1|AAY34441.1|  487|Anopheles gambiae adrenodoxin
          reductase protein.
          Length = 487

 Score = 25.8 bits (54), Expect = 0.45
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 2/41 (4%)

Query: 3  CVMGSKDPATPAEGRCVCADVGSNNSGYYRLQAVLTHRGRS 43
          CV  +   A P   R +C  VG+  +G+Y  Q +L H   S
Sbjct: 18 CVFRNASTAAPIRPR-ICI-VGAGPAGFYTAQYILKHLDNS 56


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.317    0.136    0.446 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 146,628
Number of Sequences: 2123
Number of extensions: 5398
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 125
length of database: 516,269
effective HSP length: 57
effective length of query: 68
effective length of database: 395,258
effective search space: 26877544
effective search space used: 26877544
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 43 (21.4 bits)

- SilkBase 1999-2023 -