GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002748-TA|BGIBMGA002748-PA|IPR002126|Cadherin
         (1518 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.     26   2.0  

>AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.
          Length = 602

 Score = 26.2 bits (55), Expect = 2.0
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 270 NTFVLQVQASQLNNPLKTAQARVEIELLDLNDNLPEFEVDFYNISIVENLPNGFSVLQVM 329
           N  V +++A+ + N L     +  ++L      L   E+   +IS+ ENL +G S+    
Sbjct: 495 NNAVGEMEATNVTNILSMDNTQYNLDLS--LPQLDSTELADLDISLSENLSSGLSISDST 552

Query: 330 ATDKDQGENGE 340
             +  +G N E
Sbjct: 553 KPETSKGINAE 563


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.317    0.136    0.387 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 431,841
Number of Sequences: 429
Number of extensions: 20424
Number of successful extensions: 126
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 126
Number of HSP's gapped (non-prelim): 2
length of query: 1518
length of database: 140,377
effective HSP length: 67
effective length of query: 1451
effective length of database: 111,634
effective search space: 161980934
effective search space used: 161980934
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 50 (24.2 bits)