GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002726-TA|BGIBMGA002726-PA|undefined
         (191 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC002400-2|AAC05812.1|  533|Homo sapiens Gene product with simil...    30   5.8  

>AC002400-2|AAC05812.1|  533|Homo sapiens Gene product with
           similarity to Ubiquitin binding enzyme protein.
          Length = 533

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 38  ANPVFLT-PLQAEPEPPLTAADILVSLNRRTIMGYAPNTEPFA 79
           A P+ +T PL   P PP TAA  L +  +R   G  P   PF+
Sbjct: 121 ALPLKVTGPLARNPTPPWTAAAALATRGQRPEKGLFPGPAPFS 163


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.322    0.135    0.402 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,085,608
Number of Sequences: 224733
Number of extensions: 1031484
Number of successful extensions: 4739
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4738
Number of HSP's gapped (non-prelim): 1
length of query: 191
length of database: 73,234,838
effective HSP length: 86
effective length of query: 105
effective length of database: 53,907,800
effective search space: 5660319000
effective search space used: 5660319000
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 63 (29.5 bits)